OriGene Logo

LGICZ1 (ZACN) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338782
Rabbit Polyclonal Anti-LGICZ1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY405837 Transient overexpression lysate of zinc activated ligand-gated ion channel (ZACN) 100 ug
$436.00

View other "LGICZ1 or NM_180990" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LGICZ1 antibody: synthetic peptide directed towards the N terminal of human LGICZ1. Synthetic peptide located within the following region: PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 46 kDa
Gene Name zinc activated ion channel
Database Link
Background LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels (Davies et al., 2003 PubMed 12381728). supplied by OMIM, Mar 2008. ##Evidence-Data-START## Transcript exon combination :: AB223030.1, BC110597.1 ECO:0000332 ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms L2; LGICZ; LGICZ1; ZAC; ZAC1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Rabbit: 86%; Bovine: 85%
Reference Data
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Ion Channels: Other, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.