OriGene Logo

ELOVL7 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338690
Rabbit Polyclonal Anti-ELOVL7 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY410968 Transient overexpression lysate of ELOVL family member 7, elongation of long chain fatty acids (yeast) (ELOVL7), transcript variant 1 100 ug
$436.00

View other "ELOVL7 or NM_024930" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ELOVL7 antibody: synthetic peptide directed towards the N terminal of human ELOVL7. Synthetic peptide located within the following region: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 33 kDa
Gene Name ELOVL fatty acid elongase 7
Database Link
Background ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.
Synonyms FLJ23563
Note Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.