MANEL (MANEAL) Rabbit Polyclonal Antibody

SKU TA338665

Rabbit Polyclonal Anti-MANEAL Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MANEAL antibody is: synthetic peptide directed towards the middle region of Human MANEAL. Synthetic peptide located within the following region: YTYFASNGFSFGSSHQNWKAVKNFCDANNLMFIPSVGPGYIDTSIRPWNN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: mannosidase endo-alpha like
• Database Link:
  NP_689709
  Q5VSG8
• Background: The function of this protein remains unknown.
• Synonyms: RP11-109P14.3
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane