KCNK10 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-KCNK10 antibody: synthetic peptide directed towards the C terminal of human KCNK10. Synthetic peptide located within the following region: QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEK |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 59 kDa |
| Gene Name | potassium two pore domain channel subfamily K member 10 |
| Database Link | |
| Background | The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations, and is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. provided by RefSeq, Sep 2008 |
| Synonyms | K2p10.1; PPP1R97; TREK-2; TREK2 |
| Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 85% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.