GI24 (C10orf54) Rabbit Polyclonal Antibody

CAT#: TA338488

Reviews ()
Write a review

Rabbit Polyclonal Anti-C10orf54 Antibody



Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C10orf54 antibody: synthetic peptide directed towards the N terminal of human C10orf54. Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name chromosome 10 open reading frame 54
Background The function of this protein remains unknown.
Synonyms B7-H5; B7H5; DD1alpha; GI24; PP2135; SISP1; VISTA
Note Immunogen Sequence Homology: Human: 100%; Horse: 92%; Dog: 86%; Bovine: 85%
Reference Data
Protein Families Transmembrane
Other products for "C10orf54"
Frequently bought together (3)
Recombinant protein of human chromosome 10 open reading frame 54 (C10orf54)
    • 20 ug

USD 748.00


Transient overexpression lysate of chromosome 10 open reading frame 54 (C10orf54)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies