GI24 (C10orf54) Rabbit Polyclonal Antibody

CAT#: TA338488

Reviews ()
Write a review

Rabbit Polyclonal Anti-C10orf54 Antibody


 Product Datasheet for 'TA338488'

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C10orf54 antibody: synthetic peptide directed towards the N terminal of human C10orf54. Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 34 kDa
Gene Name chromosome 10 open reading frame 54
Background The function of this protein remains unknown.
Synonyms B7-H5; B7H5; DD1alpha; GI24; PP2135; SISP1; VISTA
Note Immunogen Sequence Homology: Human: 100%; Horse: 92%; Dog: 86%; Bovine: 85%
Reference Data
Protein Families Transmembrane
Other products for "C10orf54"
Frequently bought together (2)
Transient overexpression lysate of chromosome 10 open reading frame 54 (C10orf54)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
68 Mouse Clones