Angiopoietin like 7 (ANGPTL7) Rabbit Polyclonal Antibody

SKU TA338456

Rabbit Polyclonal Anti-ANGPTL7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANGPTL7 antibody: synthetic peptide directed towards the middle region of human ANGPTL7. Synthetic peptide located within the following region: NQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: angiopoietin like 7
• Database Link:
  NP_066969
  O43827
• Background: The function of ANGPTL7 remains unknown.
• Synonyms: AngX; CDT6; dJ647M16.1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane