Filamin C (FLNC) Rabbit Polyclonal Antibody
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FLNC antibody is: synthetic peptide directed towards the N-terminal region of Human FLNC. Synthetic peptide located within the following region: VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 296 kDa |
Gene Name | filamin C |
Database Link | |
Background | This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. |
Synonyms | ABP-280; ABP280A; ABPA; ABPL; CMH26; FLN2; MFM5; MPD4; RCM5 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Pathways | Focal adhesion, MAPK signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Antibody Resources |
Other products for "FLNC"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 169.00
Customer
Reviews
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.