RGD1308134 Rabbit Polyclonal Antibody

CAT#: TA338309

Rabbit Polyclonal Anti-RGD1308134 Antibody

Product Images

WB Suggested Anti-RGD1308134 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RGD1308134 antibody is: synthetic peptide directed towards the N-terminal region of Rat RGD1308134. Synthetic peptide located within the following region: VKRFGDDLNHISCVIKERTVAQIKTTVKRKVYEDSGIPLPAESPKKGPKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: similar to RIKEN cDNA 1110020A23
• Database Link:
  NP_001120993
  Entrez Gene 287452 Rat
• Background: The function of this protein remains unknown.
• Synonyms: RGD1308134
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 86%; Zebrafish: 79%