OriGene Logo

Dynein heavy chain (DNAH9) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338182
Rabbit Polyclonal Anti-DNAH9 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Dynein heavy chain or NM_004662" antibodies

Specifications
Specifications
Product Data
Application IF, WB
Recommended Dilution IF, WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DNAH9 antibody is: synthetic peptide directed towards the C-terminal region of Human DNAH9. Synthetic peptide located within the following region: DSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 91 kDa
Gene Name dynein axonemal heavy chain 9
Database Link
Background This gene encodes the heavy chain subunit of axonemal dynein, a large multi-subunit molecular motor. Axonemal dynein attaches to microtubules and hydrolyzes ATP to mediate the movement of cilia and flagella. The gene expresses at least two transcript variants; additional variants have been described, but their full length nature has not been determined.
Synonyms DNAH17L; Dnahc9; DNEL1; DYH9; HL-20; HL20
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Pig: 83%; Bovine: 83%; Guinea pig: 83%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.