Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Rabbit Polyclonal Antibody

CAT#: TA338052

Rabbit Polyclonal Anti-DYNC1LI1 Antibody

Product Images

WB Suggested Anti-DYNC1LI1 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DYNC1LI1 antibody is: synthetic peptide directed towards the C-terminal region of Human DYNC1LI1. Synthetic peptide located within the following region: AEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: dynein cytoplasmic 1 light intermediate chain 1
• Database Link:
  NP_057225
  Entrez Gene 51143 Human
  UniProt ID Q9Y6G9
• Background: DYNC1LI1 acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. DYNC1LI1 may play a role in binding dynein to membranous organelles or chromosomes. DYNC1LI1 is probably involved in the microtubule-dependent transport of pericentrin. DYNC1LI1 is required for progress throuh the spindle assembly checkpoint. The phosphorylated form appears to be involved in the selective removal of MAD1L1 and MAD1L2 but not BUB1B from kinetochores.
• Synonyms: DLC-A; DNCLI1; LIC1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%