KIR2DL5A Rabbit Polyclonal Antibody

CAT#: TA338022

Rabbit Polyclonal Anti-KIR2DL5A Antibody


 Product Datasheet for 'TA338022'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KIR2DL5A antibody is: synthetic peptide directed towards the C-terminal region of Human KIR2DL5A. Synthetic peptide located within the following region: QLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 41kDa
Gene Name killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 5A
Background Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several 'framework' genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
Synonyms CD158F|KIR2DL5|KIR2DL5.1|KIR2DL5.3
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transmembrane
Protein Pathways Antigen processing and presentation, Natural killer cell mediated cytotoxicity, Graft-versus-host disease
Other products for "KIR2DL5A"
Frequently bought together (2)
Transient overexpression lysate of killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A (KIR2DL5A)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies