NKAIN4 Rabbit Polyclonal Antibody

CAT#: TA337866

Rabbit Polyclonal Anti-NKAIN4 Antibody

Product Images

WB Suggested Anti-NKAIN4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NKAIN4 antibody: synthetic peptide directed towards the middle region of human NKAIN4. Synthetic peptide located within the following region: LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: Na+/K+ transporting ATPase interacting 4
• Database Link:
  NP_690603
  Entrez Gene 128414 Human
  UniProt ID Q8IVV8
• Background: The specific function of NKAIN4 is not yet known.
• Synonyms: bA261N11.2; C20orf58; FAM77A
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 93%; Zebrafish: 91%; Dog: 79%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane