TBP2 (TBPL2) Rabbit Polyclonal Antibody

CAT#: TA337706

Rabbit Polyclonal Anti-TBPL2 Antibody

Product Images

WB Suggested Anti-TBPL2 Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBPL2 antibody is: synthetic peptide directed towards the N-terminal region of Human TBPL2. Synthetic peptide located within the following region: SGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: TATA-box binding protein like 2
• Database Link:
  NP_950248
  Entrez Gene 387332 Human
  UniProt ID Q6SJ96
• Background: TBPL2 is a transcription factor required in complex with TAF3 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process.
• Synonyms: TBP2; TRF3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Pathways: Basal transcription factors, Huntington's disease