RETREG3 Rabbit Polyclonal Antibody

CAT#: TA337570

Rabbit Polyclonal Anti-FAM134C Antibody

Product Images

WB Suggested Anti-FAM134C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 721_B cell lysateFAM134C is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM134C antibody: synthetic peptide directed towards the N terminal of human FAM134C. Synthetic peptide located within the following region: EAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: family with sequence similarity 134 member C
• Database Link:
  NP_835227
  Entrez Gene 162427 Human
  UniProt ID Q86VR2
• Background: FAM134C belongs to the FAM134 family
• Synonyms: FLJ33806
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane