NUP62 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-NUP62 antibody is: synthetic peptide directed towards the middle region of Human NUP62. Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 57 kDa |
| Gene Name | nucleoporin 62kDa |
| Database Link | |
| Background | The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP62 is a member of the FG-repeat containing nucleoporins and is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. |
| Synonyms | IBSN; p62; SNDI |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 77%; Horse: 77%; Mouse: 77%; Guinea pig: 77% |
| Reference Data | |
| Protein Categories | Cytokines, Growth Factors, Intracellular Proteins, Nervous system: Neurodegenerative diseases |
| Protein Families | Druggable Genome, Transcription Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.