OriGene Logo

C10orf78 (SFR1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337429
Rabbit Polyclonal Anti-SFR1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407981 Transient overexpression lysate of chromosome 10 open reading frame 78 (C10orf78), transcript variant 2 100 ug
$436.00

View other "C10orf78 or NM_145247" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SFR1 antibody is: synthetic peptide directed towards the C-terminal region of Human SFR1. Synthetic peptide located within the following region: LLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 26 kDa
Gene Name SWI5 dependent homologous recombination repair protein 1
Database Link
Background SFR1 is a component of the SWI5-SFR1 complex, a complex required for double-strand break repair via homologous recombination.
Synonyms bA373N18.1; C10orf78; MEI5; MEIR5
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 92%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.