Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody

CAT#: TA337291

Reviews ()
Write a review

Rabbit Polyclonal Anti-ASPH Antibody



USD 539.00


Availability*
2 Weeks

Size
    • 100 ul


Product images

Other products for "ASPH"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: PEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name aspartate beta-hydroxylase
Background ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transc
Synonyms AAH; BAH; CASQ2BP1; FDLAB; HAAH; JCTN; junctin
Note Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Rat: 83%; Pig: 79%; Bovine: 77%
Reference Data
Protein Families Druggable Genome, Transmembrane
Frequently bought together (3)
Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 2
    • 100 ug

USD 2,950.00


Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 2
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.