CYP27C1 Rabbit Polyclonal Antibody

SKU
TA336202
Rabbit Polyclonal Anti-CYP27C1 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CYP27C1 Antibody: synthetic peptide directed towards the middle region of human CYP27C1. Synthetic peptide located within the following region: VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 43 kDa
Gene Name cytochrome P450 family 27 subfamily C member 1
Database Link
Background The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.
Synonyms FLJ16008
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, P450
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.