Hbe1 Rabbit Polyclonal Antibody

CAT#: TA336139

Rabbit Polyclonal Anti-Hbe1 Antibody

Product Images

WB Suggested Anti-Hbe1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Hbe1 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Hbe1. Synthetic peptide located within the following region: MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: hemoglobin subunit epsilon 1
• Database Link:
  NP_001008890
  Entrez Gene 293267 Rat
• Background: The function of this protein remains unknown.
• Synonyms: Epsilon-globin; HBE; OTTHUMP00000069642
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Goat: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%