OriGene Logo

SRD5A2L2 (TECRL) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA336128
Rabbit Polyclonal Anti-Tecrl Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "SRD5A2L2 or NM_001010874" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Tecrl Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tecrl. Synthetic peptide located within the following region: AGPLKTTTAVKHSKTTHFEIEILDAHTRKQICIVDKVTQTSTIHDVKQKF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 42 kDa
Gene Name trans-2,3-enoyl-CoA reductase-like
Database Link
Background The function of this protein remains unknown.
Synonyms GPSN2L; SRD5A2L2; TERL
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Bovine: 92%; Horse: 85%; Rabbit: 85%; Pig: 83%; Guinea pig: 83%
Reference Data
Protein Categories Cardiovascular diseases, Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.