OriGene Logo

C14ORF140 (ZC2HC1C) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA335958
Rabbit Polyclonal Anti-ZC2HC1C Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY411092 Transient overexpression lysate of family with sequence similarity 164, member C (FAM164C), transcript variant 1 100 ug
$665.00
TP302554 Recombinant protein of human family with sequence similarity 164, member C (FAM164C), transcript variant 2, 20 µg
20 ug
$867.00

View other "C14ORF140 or NM_001042430" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZC2HC1C Antibody: synthetic peptide directed towards the N terminal of human ZC2HC1C. Synthetic peptide located within the following region: QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name zinc finger C2HC-type containing 1C
Database Link
Background ZC2HC1C belongs to the UPF0418 family. The exact function of ZC2HC1C remains unknown.
Synonyms C14orf140; FAM164C
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Mouse: 79%; Guinea pig: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.