TMEM91 Rabbit Polyclonal Antibody

CAT#: TA335951

Rabbit Polyclonal Anti-TMEM91 Antibody

Product Images

WB Suggested Anti-TMEM91 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMEM91 Antibody: synthetic peptide directed towards the N terminal of human TMEM91. Synthetic peptide located within the following region: SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: transmembrane protein 91
• Database Link:
  NP_001036060
  Entrez Gene 641649 Human
  UniProt ID Q6ZNR0
• Background: The function remains unknown.
• Synonyms: DSPC3; IFITMD6
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 79%

Reference Data

• Protein Families: Transmembrane