URG4 (URGCP) Rabbit Polyclonal Antibody

CAT#: TA335936

Rabbit Polyclonal Anti-URG4 Antibody

Product Images

WB Suggested Anti-URG4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-URG4 Antibody: synthetic peptide directed towards the middle region of human URG4. Synthetic peptide located within the following region: AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 100 kDa
• Gene Name: upregulator of cell proliferation
• Database Link:
  NP_001071132
  Entrez Gene 55665 Human
  UniProt ID Q8TCY9
• Background: The specific function of this protein remains unknown.URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival (Tufan et al., 2002 [PubMed 12082552]). [supplied by OMIM]
• Synonyms: URG4
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Mouse: 86%