OriGene Logo

Neuro D4 (DPF1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA335741
Rabbit Polyclonal Anti-DPF1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY427564 Transient overexpression lysate of D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 1 100 ug
$436.00
TP325651 Recombinant protein of human D4, zinc and double PHD fingers family 1 (DPF1), transcript variant 1, 20 µg
20 ug
$867.00

View other "Neuro D4 or NM_004647" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human, Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-DPF1 Antibody: synthetic peptide directed towards the middle region of human DPF1. Synthetic peptide located within the following region: KELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCAD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 40 kDa
Gene Name double PHD fingers 1
Database Link
Background Part of the d4 family of zinc finger proteins, DPF1 has been localized on chromosome 19.
Synonyms BAF45b; NEUD4; neuro-d4
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.