CTNS Rabbit Polyclonal Antibody

CAT#: TA335731

Rabbit Polyclonal Anti-Ctns Antibody

Product Images

Host: Rabbit; Target Name: Ctns; Sample Tissue: Mouse Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ctns Antibody is: synthetic peptide directed towards the middle region of Mouse Ctns. Synthetic peptide located within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Database Link:
  NP_004928
  Entrez Gene 83429 Mouse
• Background: Ctns is thought to transport cystine out of lysosomes.
• Synonyms: CTNS-LSB; PQLC4
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Pig: 92%; Rat: 92%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Lysosome