SFRS17A (AKAP17A) Rabbit Polyclonal Antibody

CAT#: TA335725

Rabbit Polyclonal Anti-AKAP17A Antibody

Product Images

WB Suggested Anti-DXYS155E Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DXYS155E Antibody: synthetic peptide directed towards the N terminal of human DXYS155E. Synthetic peptide located within the following region: NWEVMERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: A-kinase anchoring protein 17A
• Database Link:
  NP_005079
  Entrez Gene 8227 Human
  UniProt ID Q02040
• Background: DXYS155E is a gene found in the pseudoautosomal region of the distal short arms of the X and Y chromosomes, and appears to be ubiquitously expressed.
• Synonyms: 721P; AKAP-17A; CCDC133; CXYorf3; DXYS155E; PRKA17A; SFRS17A; XE7; XE7Y
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors