Coronin 1a (CORO1A) Rabbit Polyclonal Antibody

CAT#: TA335668

Rabbit Polyclonal Anti-CORO1A Antibody

Product Images

WB Suggested Anti-CORO1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Daudi cell lysate; CORO1A is supported by BioGPS gene expression data to be expressed in Daudi

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CORO1A Antibody: synthetic peptide directed towards the middle region of human CORO1A. Synthetic peptide located within the following region: SVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: coronin 1A
• Database Link:
  NP_009005
  Entrez Gene 11151 Human
  UniProt ID P31146
• Background: CORO1A forms homodimers. It plays a role in the cross-linking of F-actin in the cell.
• Synonyms: CLABP; CLIPINA; HCORO1; IMD8; p57; TACO
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%