ZNF498 (ZSCAN25) Rabbit Polyclonal Antibody

SKU TA335392

Rabbit Polyclonal Anti-ZSCAN25 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF498 Antibody: synthetic peptide directed towards the middle region of human ZNF498. Synthetic peptide located within the following region: QIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVALTSERFGEAS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: zinc finger and SCAN domain containing 25
• Database Link:
  NP_660090
  Q6NSZ9
• Background: The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Alternative splicing results in two transcript variants encoding different proteins. Additional splice variants have been identified, but their biological validity has not been determinedThis gene encodes a protein of unknown function. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions.
• Synonyms: ZNF498
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 86%

Reference Data

• Protein Families: Transcription Factors