LGALS3BP Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of lectin, galactoside-binding, soluble, 3 binding protein (LGALS3BP)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "LGALS3BP"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LGALS3BP antibody: synthetic peptide directed towards the middle region of human LGALS3BP. Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 63 kDa |
Gene Name | galectin 3 binding protein |
Database Link | |
Background | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | 90K; BTBD17B; CyCAP; gp90; M2BP; MAC-2-BP; TANGO10B |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 86%; Dog: 83%; Bovine: 83% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.