KPNA4 Rabbit Polyclonal Antibody

CAT#: TA335053

Rabbit Polyclonal Anti-KPNA4 Antibody

Product Images

KPNA4 antibody - N-terminal region validated by WB using Neuro 2A Cells at 1: 500.

• 

  WB Suggested Anti-KPNA4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysateKPNA4 is supported by BioGPS gene expression data to be expressed in HeLa

• 

  Host: Rabbit; Target Name: KPNA4; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml; KPNA4 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: KPNA4; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml; KPNA4 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KPNA4 antibody: synthetic peptide directed towards the N terminal of human KPNA4. Synthetic peptide located within the following region: KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: karyopherin subunit alpha 4
• Database Link:
  NP_002259
  Entrez Gene 16649 MouseEntrez Gene 3840 Human
  UniProt ID O00629
• Background: The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore complex. KPNA4 shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen.The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore complex. The protein encoded by this gene shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: IPOA3; QIP1; SRP3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%