C12orf68 (CCDC184) Rabbit Polyclonal Antibody

CAT#: TA334940

Rabbit Polyclonal Anti-C12orf68 Antibody

Product Images

WB Suggested Anti-C12orf68 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C12orf68 antibody: synthetic peptide directed towards the middle region of human LOC387856. Synthetic peptide located within the following region: LQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: coiled-coil domain containing 184
• Database Link:
  NP_001013657
  Entrez Gene 387856 Human
  UniProt ID Q52MB2
• Background: The exact function of LOC387856 remains unknown.
• Synonyms: C12orf68
• Note: Immunogen Sequence Homology: Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%