C6ORF154 (LRRC73) Rabbit Polyclonal Antibody

CAT#: TA334936

Reviews ()
Write a review

Rabbit Polyclonal Anti-LRRC73 Antibody


Product Datasheet for 'TA334936'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LRRC73 antibody: synthetic peptide directed towards the N terminal of human LRRC73. Synthetic peptide located within the following region: MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 33 kDa
Gene Name leucine rich repeat containing 73
Background The function of this protein remains unknown.
Synonyms C6orf154
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 85%
Reference Data
Other products for "LRRC73"
Frequently bought together (3)
Recombinant protein of human chromosome 6 open reading frame 154 (C6orf154)
    • 20 ug

USD 748.00


Transient overexpression lysate of chromosome 6 open reading frame 154 (C6orf154)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies