METRNL Rabbit Polyclonal Antibody

CAT#: TA334847

Rabbit Polyclonal Anti-METRNL Antibody

Product Images

Host: Rabbit; Target Name: METRNL; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-METRNL antibody is: synthetic peptide directed towards the C-terminal region of Human METRNL. Synthetic peptide located within the following region: GVRPGHGDFLFTGHMHFGEARLGCAPRFKDFQRMYRDAQERGLNPCEVGT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: meteorin, glial cell differentiation regulator-like
• Database Link:
  NP_001004431
  Entrez Gene 284207 Human
  UniProt ID Q641Q3
• Background: The function of this protein remains unknown.
• Synonyms: MGC99788
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 92%; Rat: 92%; Horse: 92%; Guinea pig: 92%; Yeast: 90%; Dog: 86%; Rabbit: 86%; Mouse: 77%