C3orf55 (PQLC2L) Rabbit Polyclonal Antibody

CAT#: TA334790

Reviews ()
Write a review

Rabbit Polyclonal Anti-C3orf55 Antibody


Product Datasheet for 'TA334790'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C3orf55 antibody is: synthetic peptide directed towards the N-terminal region of Human C3orf55. Synthetic peptide located within the following region: KVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Predicted Protein Size 12 kDa
Gene Name PQ loop repeat containing 2-like
Background The function of this protein remains unknown.
Synonyms C3orf55
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Other products for "PQLC2L"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies