KASH5 Rabbit Polyclonal Antibody

CAT#: TA334783

Rabbit Polyclonal Anti-CCDC155 Antibody

Product Images

Host: Rabbit; Target Name: CCDC155; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCDC155 antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC155. Synthetic peptide located within the following region: VIHETSEETEFPSEAPAGGQRNFQGEPAHPEEGRKEPSMWLTRREEEEDA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: coiled-coil domain containing 155
• Database Link:
  NP_653289
  Entrez Gene 147872 Human
  UniProt ID Q8N6L0
• Background: The function of this protein remains unknown.
• Synonyms: KASH5
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 77%