Chmp2b Rabbit Polyclonal Antibody

CAT#: TA334492

Rabbit Polyclonal Anti-Chmp2b Antibody

Product Images

WB Suggested Anti-Chmp2b Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Chmp2b antibody is: synthetic peptide directed towards the N-terminal region of Rat Chmp2b. Synthetic peptide located within the following region: ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: charged multivesicular body protein 2B
• Database Link:
  XP_001063932
  Entrez Gene 363720 Rat
• Background: Chmp2b is involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Chmp2b recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Chmp2b redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery Chmp2b also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Involved in cytokinesis .
• Synonyms: CHMP2.5; DKFZp564O123; DMT1; hVps2-2; VPS2-2; VPS2B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%