ALDH16A1 Rabbit Polyclonal Antibody

CAT#: TA334397

Rabbit Polyclonal Anti-ALDH16A1 Antibody

 Product Datasheet for 'TA334397'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ALDH16A1 antibody is: synthetic peptide directed towards the N-terminal region of Human ALDH16A1. Synthetic peptide located within the following region: YGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQDPITGENL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 33 kDa
Gene Name aldehyde dehydrogenase 16 family member A1
Background This gene encodes a member of the aldehyde dehydrogenase superfamily. The family members act on aldehyde substrates and use nicotinamide adenine dinucleotide phosphate (NADP) as a cofactor. This gene is conserved in chimpanzee, dog, cow, mouse, rat, and zebrafish. The protein encoded by this gene interacts with maspardin, a protein that when truncated is responsible for Mast syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Synonyms -
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 86%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome
Other products for "ALDH16A1"
Frequently bought together (2)
Transient overexpression lysate of aldehyde dehydrogenase 16 family, member A1 (ALDH16A1), transcript variant 1
    • 100 ug

USD 315.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones