Claudin 23 (CLDN23) Rabbit Polyclonal Antibody

CAT#: TA334206

Rabbit Polyclonal Anti-CLDN23 Antibody

Product Images

WB Suggested Anti-CLDN23 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CLDN23 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: claudin 23
• Database Link:
  NP_919260
  Entrez Gene 137075 Human
  UniProt ID Q96B33
• Background: CLDN23 is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It is a candidate tumor suppressor gene implicated in intestinal-type gastric cancer.
• Synonyms: CLDNL; hCG1646163
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 91%; Mouse: 86%; Rat: 85%; Yeast: 82%

Reference Data

• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction