C16orf93 (CCDC189) Rabbit Polyclonal Antibody

CAT#: TA334141

Rabbit Polyclonal Anti-C16orf93 Antibody

Product Images

Host: Rabbit; Target Name: C16orf93; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C16orf93 Antibody is: synthetic peptide directed towards the C-terminal region of Human C16orf93. Synthetic peptide located within the following region: ETVAPPEPEPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: coiled-coil domain containing 189
• Database Link:
  NP_001014979
  Entrez Gene 90835 Human
  UniProt ID A1A4V9
• Background: The function of this protein remains unknown.
• Synonyms: C16orf93
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 92%; Dog: 85%; Horse: 85%