TIS11B (ZFP36L1) Rabbit Polyclonal Antibody

SKU TA333957

Rabbit Polyclonal Anti-ZFP36L1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZFP36L1 Antibody: synthetic peptide directed towards the N terminal of human ZFP36L1. Synthetic peptide located within the following region: QLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: ZFP36 ring finger protein-like 1
• Database Link:
  NP_004917
  Q07352
• Background: ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
• Synonyms: Berg36; BRF1; cMG1; ERF-1; ERF1; RNF162B; TIS11B
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Human: 100%; Pig: 100%; Guinea pig: 92%; Mouse: 92%; Rat: 92%

Reference Data

• Protein Families: Transcription Factors