PDI (PDIA2) Rabbit Polyclonal Antibody

SKU TA333911

Rabbit Polyclonal Anti-PDIA2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PDIA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PDIA2. Synthetic peptide located within the following region: EFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLED
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: protein disulfide isomerase family A member 2
• Database Link:
  NP_006840
  Q13087
• Background: Protein disulfide isomerases, such as PDIP, are endoplasmic reticulum (ER) resident proteins that catalyze protein folding and thiol-disulfide interchange reactions.
• Synonyms: PDA2; PDI; PDIP; PDIR
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Pig: 93%; Dog: 92%; Horse: 86%; Guinea pig: 86%; Rat: 85%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome