C14orf142 (GON7) Rabbit Polyclonal Antibody

CAT#: TA333612

Rabbit Polyclonal Anti-C14orf142 Antibody

Product Images

Host: Rabbit; Target Name: C14orf142; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C14orf142 Antibody is: synthetic peptide directed towards the C-terminal region of Human C14orf142. Synthetic peptide located within the following region: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: chromosome 14 open reading frame 142
• Database Link:
  NP_115879
  Entrez Gene 84520 Human
  UniProt ID Q9BXV9
• Background: The function of this protein remains unknown.
• Synonyms: PNAS-127
• Note: Immunogen sequence homology: Human: 100%; Rat: 91%; Mouse: 91%; Dog: 86%; Horse: 86%; Bovine: 86%; Pig: 79%