carabin (TBC1D10C) Rabbit Polyclonal Antibody

CAT#: TA333358

Rabbit Polyclonal Anti-TBC1D10C Antibody

Product Images

WB Suggested Anti-TBC1D10C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TBC1D10C Antibody: synthetic peptide directed towards the N terminal of human TBC1D10C. Synthetic peptide located within the following region: MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: TBC1 domain family member 10C
• Database Link:
  NP_940919
  Entrez Gene 374403 Human
  UniProt ID Q8IV04
• Background: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin that also inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein activity.
• Synonyms: CARABIN; EPI64C
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 86%; Rat: 79%; Guinea pig: 79%