LXR beta (Nr1h2) Rabbit Polyclonal Antibody

CAT#: TA332017

Rabbit Polyclonal Anti-Nr1h2 Antibody

 Product Datasheet for 'TA332017'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Rat
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-Nr1h2 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Nr1h2. Synthetic peptide located within the following region: ASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 48 kDa
Gene Name nuclear receptor subfamily 1 group H member 2
Background Nr1h2 is a nuclear orphan receptor; It may be involved in modulating 9-cis-retinoic acid signaling by interacting with retinoic acid receptor (RXR).
Synonyms LXR-b; LXRB; NER; NER-I; RIP15; UNR
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Other products for "Nr1h2"
Frequently bought together (2)
Transient overexpression lysate of nuclear receptor subfamily 1, group H, member 2 (NR1H2)
    • 100 ug

USD 315.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones