C20orf4 (AAR2) Rabbit Polyclonal Antibody

CAT#: TA331950

Rabbit Polyclonal Anti-AAR2 Antibody

Product Images

Host: Rabbit; Target Name: AAR2; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml. AAR2 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AAR2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AAR2. Synthetic peptide located within the following region: KFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: AAR2 splicing factor homolog
• Database Link:
  NP_056326
  Entrez Gene 25980 Human
  UniProt ID Q9Y312
• Background: The function of this protein remains unknown.
• Synonyms: C20orf4; CGI-23
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%