CARS2 Rabbit Polyclonal Antibody

CAT#: TA331742

Rabbit Polyclonal Anti-CARS2 Antibody

Product Images

Host: Rabbit; Target Name: CARS2; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CARS2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARS2. Synthetic peptide located within the following region: GNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: cysteinyl-tRNA synthetase 2, mitochondrial (putative)
• Database Link:
  NP_078813
  Entrez Gene 79587 Human
  UniProt ID Q9HA77
• Background: The function of this protein remains unknown.
• Synonyms: COXPD27; cysRS
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 86%; Rat: 85%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Aminoacyl-tRNA biosynthesis