OriGene Logo

REXO1L1 (REXO1L1P) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA331602
Rabbit Polyclonal Anti-REXO1L1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
In Control Promo
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY406758 Transient overexpression lysate of REX1, RNA exonuclease 1 homolog (S. cerevisiae)-like 1 (REXO1L1)
100 ug
$665.00

View other "REXO1L1 or NM_172239" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-REXO1L1 Antibody is: synthetic peptide directed towards the middle region of Human REXO1L1. Synthetic peptide located within the following region: ASSSQRSRGSKVGRQPGKTRNRSGMACKTTATTSSKRIVRRASLPSLSLK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 74 kDa
Gene Name REX1, RNA exonuclease 1 homolog-like 1, pseudogene
Database Link
Background The function of this protein remains unknown.
Synonyms GOR
Note Immunogen sequence homology: Human: 100%
Reference Data
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.