Protein cornichon homolog 2 (CNIH2) Rabbit Polyclonal Antibody

CAT#: TA331545

Rabbit Polyclonal Anti-CNIH2 Antibody

Product Images

Host: Rabbit; Target Name: CNIH2; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CNIH2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNIH2. Synthetic peptide located within the following region: LWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: cornichon family AMPA receptor auxiliary protein 2
• Database Link:
  NP_872359
  Entrez Gene 254263 Human
  UniProt ID Q6PI25
• Background: The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Type I AMPA receptor regulatory protein isoform gamma-8 to control assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. Alternative splicing results in multiple transcript variants.
• Synonyms: CNIH-2; Cnil
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Zebrafish: 93%; Horse: 92%; Bovine: 92%; Rabbit: 77%

Reference Data

• Protein Families: Transmembrane