ZRANB2 Rabbit Polyclonal Antibody

CAT#: TA331505

Rabbit Polyclonal Anti-ZNF265 Antibody

Product Images

WB Suggested Anti-ZNF265 Antibody Titration: 1.25ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF265 Antibody: synthetic peptide directed towards the N terminal of human ZNF265. Synthetic peptide located within the following region: RCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: zinc finger RANBP2-type containing 2
• Database Link:
  NP_976225
  Entrez Gene 9406 Human
  UniProt ID O95218
• Background: ZNF265 is a protein that has been shown to bind to the spliceosomal components U1-70K and U2AF35 and to direct alternative splicing. Analysis of the structure reveals substantial similarity to known RNA-binding motifs in terms of the distribution of key surface residues responsible for making RNA contacts, despite a complete lack of structural homology. An RNA gel shift assay was used to demonstrate that a single crossed finger domain from ZNF265 is capable of binding to an RNA message. Taken together, these results define a new RNA-binding motif and should provide insight into the functions of the >100 uncharacterized proteins in the sequence data bases that contain this domain.
• Synonyms: ZIS; ZIS1; ZIS2; ZNF265
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors