GAS2L3 Rabbit Polyclonal Antibody

CAT#: TA331428

Rabbit polyclonal Anti-GAS2L3 Antibody

 Product Datasheet for 'TA331428'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-GAS2L3 antibody is: synthetic peptide directed towards the N-terminal region of HUMAN GAS2L3. Synthetic peptide located within the following region: SISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGDKIL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 64 kDa
Gene Name growth arrest specific 2 like 3
Background The function of this protein remains unknown.
Synonyms G2L3
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Reference Data
Other products for "GAS2L3"
Frequently bought together (2)
Transient overexpression lysate of growth arrest-specific 2 like 3 (GAS2L3)
    • 100 ug

USD 315.00

beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones